PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr001048.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family GRAS
Protein Properties Length: 508aa    MW: 56794.4 Da    PI: 5.0599
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr001048.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS347.71.9e-1061265063374
         GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNq 100
                  elLle A+a+++++ +++q+l++ l+el sp+gd+ q+la+yf++AL +r+++s++++y++l + ++++ + +++ + +  f+evsP+ +f+h++ N 
  Pbr001048.1 126 ELLLETARAIADKNSSRVQQLMWMLNELGSPYGDTDQKLASYFLQALFSRMTDSGDSCYRTLISASEKTCSFESTRKTVLKFQEVSPWTTFGHVASNG 223
                  69***********************************************************96655554444444344445***************** PP

         GRAS 101 aIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg.......skeeleetgerLakfAeelgvpfefnvlvak.rledle 190
                  aI+ea++ge ++HiiD++ ++++QWp+Ll+aLa+R++++p+lR+T+v++++++        ++ ++e+g r++kfA+ +gvpf+fn+++++ +l++l+
  Pbr001048.1 224 AIMEAFDGEPKLHIIDISNTYCTQWPTLLEALATRTDETPHLRLTTVVANRANdgsggaaAQKVMKEIGARMEKFARLMGVPFKFNAVHHSgDLSELN 321
                  ***********************************************9988778999*99999*************************8888****** PP

         GRAS 191 leeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnse....sFlerflealeyysalfdsleaklpreseerik 284
                  l+e++++ +Eala+n+v  lh++     s+ ++rd ++++++sl+P+++++ve+ead++ +    +F+++f e+l+++ + f++l+++++r+s+er  
  Pbr001048.1 322 LSEFDIRDDEALAINCVGTLHSVQ----SVGNRRDYLVSAFRSLRPRIITLVEEEADLDVGvdgiDFVHGFQECLRWFRVYFEALDESFSRTSNERLI 415
                  ***********************7....888899*********************99865556669******************************** PP

         GRAS 285 vErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrve...eesgslvlgWkdrpLvsvSaWr 374
                  +Er+  gr++v++vac+ +e++er+et+++W++r++ aGF+p+ +s+++ +++++llr++k +g+ +    ++ + ++l Wkd+p+v++SaWr
  Pbr001048.1 416 LERA-AGRAVVDLVACSPSESVERRETASRWSRRMHGAGFSPAMFSDEVCDDVRALLRRYK-EGWAMTqctDSVAGIFLSWKDQPVVWASAWR 506
                  ****.********************************************************.6655542325566777**************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098551.08798484IPR005202Transcription factor GRAS
PfamPF035146.6E-104126506IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 508 aa     Download sequence    Send to blast
MDTLFRLVNL QSDHHQSFTN STTARTSTPT TTTTTSSSSR SSFLSNPPHP NYPHQDDDVG  60
EECFNFFMDE EDFSSSSSKH YFPSNHPTPP TPNPLPTITT TPTPADFSFS PSLVNFELSN  120
DKWAPELLLE TARAIADKNS SRVQQLMWML NELGSPYGDT DQKLASYFLQ ALFSRMTDSG  180
DSCYRTLISA SEKTCSFEST RKTVLKFQEV SPWTTFGHVA SNGAIMEAFD GEPKLHIIDI  240
SNTYCTQWPT LLEALATRTD ETPHLRLTTV VANRANDGSG GAAAQKVMKE IGARMEKFAR  300
LMGVPFKFNA VHHSGDLSEL NLSEFDIRDD EALAINCVGT LHSVQSVGNR RDYLVSAFRS  360
LRPRIITLVE EEADLDVGVD GIDFVHGFQE CLRWFRVYFE ALDESFSRTS NERLILERAA  420
GRAVVDLVAC SPSESVERRE TASRWSRRMH GAGFSPAMFS DEVCDDVRAL LRRYKEGWAM  480
TQCTDSVAGI FLSWKDQPVV WASAWRP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A8e-3515850637375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009362574.10.0PREDICTED: protein SHORT-ROOT-like
SwissprotQ9SZF70.0SHR_ARATH; Protein SHORT-ROOT
TrEMBLM5VXS80.0M5VXS8_PRUPE; Uncharacterized protein
STRINGVIT_07s0129g00030.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF129734106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37650.10.0GRAS family protein